EIF2S2 monoclonal antibody (M09), clone 2F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody (M09), clone 2F3.
Lane 1: EIF2S2 transfected lysate(38.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF2S2 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to EIF2S2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF2S2.
Immunogen
EIF2S2 (NP_003899.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody (M09), clone 2F3.
Lane 1: EIF2S2 transfected lysate(38.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF2S2 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EIF2S2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — EIF2S2
Entrez GeneID
8894GeneBank Accession#
NM_003908Protein Accession#
NP_003899.2Gene Name
EIF2S2
Gene Alias
DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC8508
Gene Description
eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Omim ID
603908Gene Ontology
HyperlinkGene Summary
Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq
Other Designations
OTTHUMP00000030680|eukaryotic initiation factor 2-beta|eukaryotic translation initiation factor 2 beta|eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com