FUBP1 monoclonal antibody (M01), clone 3H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FUBP1.
Immunogen
FUBP1 (NP_003893, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FUBP1 expression in transfected 293T cell line by FUBP1 monoclonal antibody (M01), clone 3H4.
Lane 1: FUBP1 transfected lysate(68.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FUBP1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FUBP1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of FUBP1 over-expressed 293 cell line, cotransfected with FUBP1 Validated Chimera RNAi ( Cat # H00008880-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FUBP1 monoclonal antibody (M01), clone 3H4 (Cat # H00008880-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to FUBP1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — FUBP1
Entrez GeneID
8880GeneBank Accession#
NM_003902Protein Accession#
NP_003893Gene Name
FUBP1
Gene Alias
FBP, FUBP
Gene Description
far upstream element (FUSE) binding protein 1
Omim ID
603444Gene Ontology
HyperlinkGene Summary
This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. [provided by RefSeq
Other Designations
DNA helicase V|FUSE-binding protein|OTTHUMP00000038483|far upstream element binding protein|far upstream element-binding protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com