ARHGEF7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ARHGEF7 partial ORF ( NP_663788, 102 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Interspecies Antigen Sequence
Mouse (93); Rat (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARHGEF7
Entrez GeneID
8874GeneBank Accession#
NM_145735Protein Accession#
NP_663788Gene Name
ARHGEF7
Gene Alias
BETA-PIX, COOL1, DKFZp686C12170, DKFZp761K1021, KIAA0142, KIAA0412, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Gene Description
Rho guanine nucleotide exchange factor (GEF) 7
Omim ID
605477Gene Ontology
HyperlinkGene Summary
Rho GTPases play a fundamental role in numerous cellular processes triggered by extracellular stimuli that work through G protein coupled receptors. The encoded protein belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. This protein can induce membrane ruffling. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000178804|PAK-interacting exchange factor beta|SH3 domain-containing proline-rich protein|guanine nucleotide exchange factor 7|rho guanine nucleotide exchange factor 7
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com