Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARHGEF7 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008874-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARHGEF7 partial ORF ( NP_663788, 102 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008874-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8874
  • Gene Name:
  • ARHGEF7
  • Gene Alias:
  • BETA-PIX,COOL1,DKFZp686C12170,DKFZp761K1021,KIAA0142,KIAA0412,Nbla10314,P50,P50BP,P85,P85COOL1,P85SPR,PAK3,PIXB
  • Gene Description:
  • Rho guanine nucleotide exchange factor (GEF) 7
  • Gene Summary:
  • Rho GTPases play a fundamental role in numerous cellular processes triggered by extracellular stimuli that work through G protein coupled receptors. The encoded protein belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. This protein can induce membrane ruffling. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000178804,PAK-interacting exchange factor beta,SH3 domain-containing proline-rich protein,guanine nucleotide exchange factor 7,rho guanine nucleotide exchange factor 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook