SYNJ2 monoclonal antibody (M02), clone 2H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody (M02), clone 2H8.
Lane 1: SYNJ2 transfected lysate(92.2 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of SYNJ2 over-expressed 293 cell line, cotransfected with SYNJ2 Validated Chimera RNAi ( Cat # H00008871-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SYNJ2 monoclonal antibody (M02), clone 2H8 (Cat # H00008871-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SYNJ2.
Immunogen
SYNJ2 (NP_003889, 1396 a.a. ~ 1495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (79)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody (M02), clone 2H8.
Lane 1: SYNJ2 transfected lysate(92.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SYNJ2 over-expressed 293 cell line, cotransfected with SYNJ2 Validated Chimera RNAi ( Cat # H00008871-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SYNJ2 monoclonal antibody (M02), clone 2H8 (Cat # H00008871-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — SYNJ2
Entrez GeneID
8871GeneBank Accession#
NM_003898Protein Accession#
NP_003889Gene Name
SYNJ2
Gene Alias
INPP5H, KIAA0348, MGC44422
Gene Description
synaptojanin 2
Omim ID
609410Gene Ontology
HyperlinkGene Summary
Synaptojanin-2 is a ubiquitously expressed inositol polyphosphate 5-phosphatase (Malecz et al., 2000 [PubMed 11084340]).[supplied by OMIM
Other Designations
OTTHUMP00000017494|inositol phosphate 5'-phosphatase 2 (synaptojanin 2)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com