Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SYNJ2 monoclonal antibody (M02), clone 2H8

  • Catalog # : H00008871-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SYNJ2.
  • Immunogen:
  • SYNJ2 (NP_003889, 1396 a.a. ~ 1495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008871-M02
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody (M02), clone 2H8.

    Lane 1: SYNJ2 transfected lysate(92.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of SYNJ2 over-expressed 293 cell line, cotransfected with SYNJ2 Validated Chimera RNAi ( Cat # H00008871-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SYNJ2 monoclonal antibody (M02), clone 2H8 (Cat # H00008871-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8871
  • Gene Name:
  • SYNJ2
  • Gene Alias:
  • INPP5H,KIAA0348,MGC44422
  • Gene Description:
  • synaptojanin 2
  • Gene Summary:
  • Synaptojanin-2 is a ubiquitously expressed inositol polyphosphate 5-phosphatase (Malecz et al., 2000 [PubMed 11084340]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000017494,inositol phosphate 5'-phosphatase 2 (synaptojanin 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook