Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SYNJ1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008867-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SYNJ1 partial ORF ( NP_003886, 1474 a.a. - 1573 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008867-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8867
  • Gene Name:
  • SYNJ1
  • Gene Alias:
  • INPP5G
  • Gene Description:
  • synaptojanin 1
  • Gene Summary:
  • Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.[supplied by RefSeq
  • Other Designations:
  • OTTHUMP00000067399,inositol 5'-phosphatase (synaptojanin 1),synaptojanin-1, polyphosphoinositide phosphatase
  • RSS
  • YouTube
  • Linkedin
  • Facebook