PER2 monoclonal antibody (M01), clone 5C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PER2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PER2 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PER2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PER2.
Immunogen
PER2 (NP_073728, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PER2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PER2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PER2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PER2
Entrez GeneID
8864GeneBank Accession#
NM_022817Protein Accession#
NP_073728Gene Name
PER2
Gene Alias
FASPS, KIAA0347
Gene Description
period homolog 2 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq
Other Designations
period 2|period circadian protein 2|period, Drosophila, homolog of, 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.
Liu B, Xu K, Jiang Y, Li X.
International Journal of Clinical and Experimental Pathology 2014 Oct; 7(11):7863.
Application：IHC-P, Human, Lung, NSCLC.
-
Prognostic relevance of Period1 (Per1) and Period2 (Per2) expression in human gastric cancer.
Zhao H, Zeng ZL, Yang J, Jin Y, Qiu MZ, Hu XY, Han J, Liu KY, Liao JW, Xu RH, Zou QF.
International Journal of Clinical and Experimental Pathology 2014 Jan; 7(2):619.
Application：IHC-P, Human, Gastric.
-
Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com