AKAP4 monoclonal antibody (M02), clone 4C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKAP4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP4 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKAP4.
Immunogen
AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKAP4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP4 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — AKAP4
Entrez GeneID
8852GeneBank Accession#
NM_003886Protein Accession#
NP_003877Gene Name
AKAP4
Gene Alias
AKAP82, FSC1, HI, hAKAP82, p82
Gene Description
A kinase (PRKA) anchor protein 4
Omim ID
300185Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
A-kinase anchor protein 4|A-kinase anchor protein 82 kDa|OTTHUMP00000023288|OTTHUMP00000023289|protein kinase A anchoring protein 4|testis-specific gene HI
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com