CDK5R1 monoclonal antibody (M01), clone 4G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDK5R1.
Immunogen
CDK5R1 (AAH20580, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDK5R1 expression in transfected 293T cell line by CDK5R1 monoclonal antibody (M01), clone 4G11.
Lane 1: CDK5R1 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK5R1 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDK5R1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CDK5R1
Entrez GeneID
8851GeneBank Accession#
BC020580Protein Accession#
AAH20580Gene Name
CDK5R1
Gene Alias
CDK5P35, CDK5R, MGC33831, NCK5A, p23, p25, p35, p35nck5a
Gene Description
cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Omim ID
603460Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq
Other Designations
CDK5 activator 1|TPKII regulatory subunit|cyclin-dependent kinase 5 activator 1|cyclin-dependent kinase 5, regulatory subunit 1|neuronal CDK5 activator|regulatory partner for CDK5 kinase|tau protein kinase II 23kDa subunit
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com