PCAF monoclonal antibody (M06), clone 5E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human thyroid(diffuse hyperplasia).
Western Blot (Tissue lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human uterus myoma.
Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in C32 ( Cat # L002V1 ).
Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5 Western Blot analysis of PCAF expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in Raw 264.7(Cat # L024V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCAF is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PCAF on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCAF.
Immunogen
PCAF (AAH60823, 353 a.a. ~ 452 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human thyroid(diffuse hyperplasia).Western Blot (Tissue lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human uterus myoma.Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in C32 ( Cat # L002V1 ).Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5 Western Blot analysis of PCAF expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCAF is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PCAF on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — KAT2B
Entrez GeneID
8850GeneBank Accession#
BC060823Protein Accession#
AAH60823Gene Name
KAT2B
Gene Alias
CAF, P, P/CAF, PCAF
Gene Description
K(lysine) acetyltransferase 2B
Omim ID
602303Gene Ontology
HyperlinkGene Summary
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq
Other Designations
CREBBP-associated factor|p300/CBP-associated factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com