Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSC22D1 monoclonal antibody (M01), clone 1G7

  • Catalog # : H00008848-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant TSC22D1.
  • Immunogen:
  • TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008848-M01
    Western Blot detection against Immunogen (41.58 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M01), clone 1G7.

    Lane 1: TSC22D1 transfected lysate(15.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TSC22D1 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8848
  • Gene Name:
  • TSC22D1
  • Gene Alias:
  • DKFZp686O19206,MGC17597,RP11-269C23.2,TGFB1I4,TSC22
  • Gene Description:
  • TSC22 domain family, member 1
  • Gene Summary:
  • TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000040978,TSC22 domain family 1, isoform 2,transforming growth factor beta 1 induced transcript 4,transforming growth factor beta-stimulated protein TSC-22
  • RSS
  • YouTube
  • Linkedin
  • Facebook