TSC22D1 monoclonal antibody (M01), clone 1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TSC22D1.
Immunogen
TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.58 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody (M01), clone 1G7.
Lane 1: TSC22D1 transfected lysate(15.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSC22D1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TSC22D1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TSC22D1
Entrez GeneID
8848GeneBank Accession#
BC000456Protein Accession#
AAH00456Gene Name
TSC22D1
Gene Alias
DKFZp686O19206, MGC17597, RP11-269C23.2, TGFB1I4, TSC22
Gene Description
TSC22 domain family, member 1
Omim ID
607715Gene Ontology
HyperlinkGene Summary
TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM
Other Designations
OTTHUMP00000040978|TSC22 domain family 1, isoform 2|transforming growth factor beta 1 induced transcript 4|transforming growth factor beta-stimulated protein TSC-22
-
Interactome
-
Disease
-
Publication Reference
-
Regulation of c-MYC transcriptional activity by transforming growth factor-beta 1-stimulated clone 22.
Zheng L, Suzuki H, Nakajo Y, Nakano A, Kato M.
Cancer Science 2018 Feb; 109(2):395.
Application:IF, WB-Tr, Human, HaCaT cells.
-
Regulation of c-MYC transcriptional activity by transforming growth factor-beta 1-stimulated clone 22.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com