Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSC22D1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00008848-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TSC22D1 protein.
  • Immunogen:
  • TSC22D1 (NP_006013.1, 1 a.a. ~ 144 a.a) full-length human protein.
  • Sequence:
  • MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TSC22D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela S3 NE.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSC22D1 expression in transfected 293T cell line (H00008848-T02) by TSC22D1 MaxPab polyclonal antibody.

    Lane 1: TSC22D1 transfected lysate(15.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of TSC22D1 transfected lysate using anti-TSC22D1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TSC22D1 purified MaxPab mouse polyclonal antibody (B01P) (H00008848-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8848
  • Gene Name:
  • TSC22D1
  • Gene Alias:
  • DKFZp686O19206,MGC17597,RP11-269C23.2,TGFB1I4,TSC22
  • Gene Description:
  • TSC22 domain family, member 1
  • Gene Summary:
  • TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000040978,TSC22 domain family 1, isoform 2,transforming growth factor beta 1 induced transcript 4,transforming growth factor beta-stimulated protein TSC-22
  • RSS
  • YouTube
  • Linkedin
  • Facebook