TSC22D1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TSC22D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of TSC22D1 expression in transfected 293T cell line (H00008848-T02) by TSC22D1 MaxPab polyclonal antibody.
Lane 1: TSC22D1 transfected lysate(15.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TSC22D1 transfected lysate using anti-TSC22D1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TSC22D1 purified MaxPab mouse polyclonal antibody (B01P) (H00008848-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TSC22D1 protein.
Immunogen
TSC22D1 (NP_006013.1, 1 a.a. ~ 144 a.a) full-length human protein.
Sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TSC22D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of TSC22D1 expression in transfected 293T cell line (H00008848-T02) by TSC22D1 MaxPab polyclonal antibody.
Lane 1: TSC22D1 transfected lysate(15.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TSC22D1 transfected lysate using anti-TSC22D1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TSC22D1 purified MaxPab mouse polyclonal antibody (B01P) (H00008848-B01P). -
Gene Info — TSC22D1
Entrez GeneID
8848GeneBank Accession#
NM_006022.2Protein Accession#
NP_006013.1Gene Name
TSC22D1
Gene Alias
DKFZp686O19206, MGC17597, RP11-269C23.2, TGFB1I4, TSC22
Gene Description
TSC22 domain family, member 1
Omim ID
607715Gene Ontology
HyperlinkGene Summary
TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM
Other Designations
OTTHUMP00000040978|TSC22 domain family 1, isoform 2|transforming growth factor beta 1 induced transcript 4|transforming growth factor beta-stimulated protein TSC-22
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com