PROM1 monoclonal antibody (M08), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PROM1.
Immunogen
PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.2
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PROM1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — PROM1
Entrez GeneID
8842GeneBank Accession#
NM_006017Protein Accession#
NP_006008Gene Name
PROM1
Gene Alias
AC133, CD133, MSTP061, PROML1, RP41
Gene Description
prominin 1
Omim ID
604365Gene Ontology
HyperlinkGene Summary
This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
hProminin|hematopoietic stem cell antigen|prominin-like 1
-
Interactome
-
Disease
-
Publication Reference
-
Pathological Relationship Between Adamantinomatous Craniopharyngioma and Adjacent Structures Based on QST Classification.
Liu Y, Qi ST, Wang CH, Pan J, Fan J, Peng JX, Zhang X, Bao Y, Liu YW.
Journal of Neuropathology and Eexperimental Neurology 2018 Nov; 77(11):1017.
Application:IHC-P, Human, Human adamantinomatous craniopharyngiomas.
-
Dual-targeting immunoliposomes using angiopep-2 and CD133 antibody for glioblastoma stem cells.
Kim JS, Shin DH, Kim JS.
Journal of Controlled Release : Official Journal of the Controlled Release Society 2017 Nov; 269:245.
Application:Conjugation, Flow Cyt, Func, Human, U87MG cells.
-
Pathological Relationship Between Adamantinomatous Craniopharyngioma and Adjacent Structures Based on QST Classification.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com