WISP2 monoclonal antibody (M09), clone 3D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant WISP2.
Immunogen
WISP2 (AAH17782.1, 24 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDCSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (70)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (50.71 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WISP2 expression in transfected 293T cell line by WISP2 monoclonal antibody (M09), clone 3D10.
Lane 1: WISP2 transfected lysate(26.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of WISP2 transfected lysate using anti-WISP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with WISP2 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — WISP2
Entrez GeneID
8839GeneBank Accession#
BC017782Protein Accession#
AAH17782.1Gene Name
WISP2
Gene Alias
CCN5, CT58, CTGF-L
Gene Description
WNT1 inducible signaling pathway protein 2
Omim ID
603399Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. [provided by RefSeq
Other Designations
OTTHUMP00000031770|OTTHUMP00000063227|connective tissue growth factor-like protein|wnt-1 signaling pathway protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com