SOCS2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SOCS2 full-length ORF ( NP_003868.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.6
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SOCS2
Entrez GeneID
8835GeneBank Accession#
NM_003877.3Protein Accession#
NP_003868.1Gene Name
SOCS2
Gene Alias
CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
Gene Description
suppressor of cytokine signaling 2
Omim ID
605117Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10 and interferon (IFN)-gamma. The protein encoded by this gene is found to interact with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R), and thus is thought to be involved in the regulation of IGF1R mediated cell signaling. Knockout studies in mice also suggested a regulatory role of this gene in IGF-1 related growth control. [provided by RefSeq
Other Designations
STAT induced STAT inhibitor-2|cytokine-inducible SH2 protein 2|suppressor of cytokine signaling-2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
KIAA0317 regulates pulmonary inflammation through SOCS2 degradation.
Lear TB, McKelvey AC, Evankovich JW, Rajbhandari S, Coon TA, Dunn SR, Londino JD, McVerry BJ, Zhang Y, Valenzi E, Burton CL, Gordon R, Gingras S, Lockwood KC, Jurczak MJ, Lafyatis R, Shlomchik MJ, Liu Y, Chen BB.
JCI Insight 2019 Oct; 4(19):129110.
Application：Incubated, Recombinant protein.
-
STAT5A-mediated SOCS2 expression regulates Jak2 and STAT3 activity following c-Src inhibition in head and neck squamous carcinoma.
Sen B, Peng SH, Woods DM, Wistuba II, Bell D, El-Naggar AK, Lai SY, Johnson FM.
Clinical Cancer Research 2012 Jan; 18(1):127.
Application：WB-Ce, WB-Tr, Human, TU167, Osc19 cell.
-
KIAA0317 regulates pulmonary inflammation through SOCS2 degradation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com