Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOCS2 polyclonal antibody (A01)

  • Catalog # : H00008835-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SOCS2.
  • Immunogen:
  • SOCS2 (AAH10399, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008835-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8835
  • Gene Name:
  • SOCS2
  • Gene Alias:
  • CIS2,Cish2,SOCS-2,SSI-2,SSI2,STATI2
  • Gene Description:
  • suppressor of cytokine signaling 2
  • Gene Summary:
  • This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10 and interferon (IFN)-gamma. The protein encoded by this gene is found to interact with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R), and thus is thought to be involved in the regulation of IGF1R mediated cell signaling. Knockout studies in mice also suggested a regulatory role of this gene in IGF-1 related growth control. [provided by RefSeq
  • Other Designations:
  • STAT induced STAT inhibitor-2,cytokine-inducible SH2 protein 2,suppressor of cytokine signaling-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook