Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NRP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008829-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NRP1 partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00008829-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8829
  • Gene Name:
  • NRP1
  • Gene Alias:
  • BDCA4,CD304,DKFZp686A03134,DKFZp781F1414,NP1,NRP,VEGF165R
  • Gene Description:
  • neuropilin 1
  • Gene Summary:
  • NRP1 is a membrane-bound coreceptor to a tyrosine kinase receptor for both vascular endothelial growth factor (VEGF; MIM 192240) and semaphorin (see SEMA3A; MIM 603961) family members. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000020818,OTTHUMP00000020820,OTTHUMP00000020821,neuropilin-1,transmembrane receptor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook