IQGAP1 monoclonal antibody (M01), clone 2C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IQGAP1.
Immunogen
IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (92)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IQGAP1 monoclonal antibody (M01), clone 2C5 Western Blot analysis of IQGAP1 expression in C32 ( Cat # L002V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to IQGAP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — IQGAP1
Entrez GeneID
8826GeneBank Accession#
NM_003870Protein Accession#
NP_003861Gene Name
IQGAP1
Gene Alias
HUMORFA01, KIAA0051, SAR1, p195
Gene Description
IQ motif containing GTPase activating protein 1
Omim ID
603379Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines. [provided by RefSeq
Other Designations
RasGAP-like with IQ motifs
-
Interactome
-
Pathway
-
Publication Reference
-
AMD1 upregulates hepatocellular carcinoma cells stemness by FTO mediated mRNA demethylation.
Xinyu Bian, Dongmin Shi, Kailin Xing, Hongxin Zhou, Lili Lu, Dahai Yu, Weizhong Wu.
Clinical and Translational Medicine 2021 Mar; 11(3):e352.
Application:IF, Human, PLC cells.
-
AMD1 upregulates hepatocellular carcinoma cells stemness by FTO mediated mRNA demethylation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com