Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IQGAP1 monoclonal antibody (M01), clone 2C5

  • Catalog # : H00008826-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IQGAP1.
  • Immunogen:
  • IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008826-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IQGAP1 monoclonal antibody (M01), clone 2C5 Western Blot analysis of IQGAP1 expression in C32 ( Cat # L002V1 ).
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8826
  • Gene Name:
  • IQGAP1
  • Gene Alias:
  • HUMORFA01,KIAA0051,SAR1,p195
  • Gene Description:
  • IQ motif containing GTPase activating protein 1
  • Gene Summary:
  • This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines. [provided by RefSeq
  • Other Designations:
  • RasGAP-like with IQ motifs
  • RSS
  • YouTube
  • Linkedin
  • Facebook