Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIN7A purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00008825-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human LIN7A protein.
  • Immunogen:
  • LIN7A (NP_004655.1, 1 a.a. ~ 233 a.a) full-length human protein.
  • Sequence:
  • MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LIN7A expression in transfected 293T cell line (H00008825-T01) by LIN7A MaxPab polyclonal antibody.

    Lane 1: LIN7A transfected lysate(25.63 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8825
  • Gene Name:
  • LIN7A
  • Gene Alias:
  • LIN-7A,LIN7,MALS-1,MGC148143,TIP-33,VELI1
  • Gene Description:
  • lin-7 homolog A (C. elegans)
  • Other Designations:
  • lin-7 homolog A,mammalian LIN-7 1,tax interaction protein 33,vertebrate LIN7 homolog 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook