Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

INPP4B monoclonal antibody (M03), clone 3F2

  • Catalog # : H00008821-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant INPP4B.
  • Immunogen:
  • INPP4B (AAH05273, 1 a.a. ~ 53 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008821-M03
    Western Blot detection against Immunogen (31.57 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged INPP4B is 1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8821
  • Gene Name:
  • INPP4B
  • Gene Alias:
  • MGC132014
  • Gene Description:
  • inositol polyphosphate-4-phosphatase, type II, 105kDa
  • Gene Summary:
  • INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq
  • Other Designations:
  • inositol polyphosphate 4-phosphatase II; 4-phosphatase II,inositol polyphosphate-4-phosphatase, type II, 105kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook