Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SAP30 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008819-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SAP30 partial ORF ( NP_003855, 131 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008819-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8819
  • Gene Name:
  • SAP30
  • Gene Alias:
  • -
  • Gene Description:
  • Sin3A-associated protein, 30kDa
  • Gene Summary:
  • Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP18, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This complex is active in deacetylating core histone octamers, but inactive in deacetylating nucleosomal histones. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq
  • Other Designations:
  • Sin3 corepressor complex subunit SAP30,Sin3-associated polypeptide, 30kDa,histone deacetylase complex subunit SAP30
  • RSS
  • YouTube
  • Linkedin
  • Facebook