SAP30 monoclonal antibody (M02), clone 4D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SAP30 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAP30 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAP30 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SAP30.
Immunogen
SAP30 (NP_003855, 131 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SAP30 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAP30 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAP30 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SAP30
Entrez GeneID
8819GeneBank Accession#
NM_003864Protein Accession#
NP_003855Gene Name
SAP30
Gene Alias
-
Gene Description
Sin3A-associated protein, 30kDa
Omim ID
603378Gene Ontology
HyperlinkGene Summary
Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP18, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This complex is active in deacetylating core histone octamers, but inactive in deacetylating nucleosomal histones. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq
Other Designations
Sin3 corepressor complex subunit SAP30|Sin3-associated polypeptide, 30kDa|histone deacetylase complex subunit SAP30
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com