SAP30 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SAP30 MaxPab polyclonal antibody. Western Blot analysis of SAP30 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of SAP30 expression in transfected 293T cell line (H00008819-T01) by SAP30 MaxPab polyclonal antibody.
Lane 1: SAP30 transfected lysate(24.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SAP30 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SAP30 protein.
Immunogen
SAP30 (NP_003855.1, 1 a.a. ~ 220 a.a) full-length human protein.
Sequence
MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SAP30 MaxPab polyclonal antibody. Western Blot analysis of SAP30 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of SAP30 expression in transfected 293T cell line (H00008819-T01) by SAP30 MaxPab polyclonal antibody.
Lane 1: SAP30 transfected lysate(24.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SAP30 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SAP30
Entrez GeneID
8819GeneBank Accession#
NM_003864.3Protein Accession#
NP_003855.1Gene Name
SAP30
Gene Alias
-
Gene Description
Sin3A-associated protein, 30kDa
Omim ID
603378Gene Ontology
HyperlinkGene Summary
Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP18, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This complex is active in deacetylating core histone octamers, but inactive in deacetylating nucleosomal histones. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq
Other Designations
Sin3 corepressor complex subunit SAP30|Sin3-associated polypeptide, 30kDa|histone deacetylase complex subunit SAP30
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com