IL18RAP monoclonal antibody (M04), clone 4G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IL18RAP.
Immunogen
IL18RAP (NP_003844, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL18RAP expression in transfected 293T cell line by IL18RAP monoclonal antibody (M04), clone 4G4.
Lane 1: IL18RAP transfected lysate (Predicted MW: 68.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL18RAP is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — IL18RAP
Entrez GeneID
8807GeneBank Accession#
NM_003853Protein Accession#
NP_003844Gene Name
IL18RAP
Gene Alias
ACPL, CD218b, CDw218b, IL18RB, MGC120589, MGC120590
Gene Description
interleukin 18 receptor accessory protein
Omim ID
604509Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18. [provided by RefSeq
Other Designations
IL-18 receptor beta|OTTHUMP00000161337|accessory protein-like
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Gene expression profiling in the synovium identifies a predictive signature of absence of response to adalimumab therapy in rheumatoid arthritis.
Badot V, Galant C, Nzeusseu Toukap A, Theate I, Maudoux AL, Van den Eynde BJ, Durez P, Houssiau FA, Lauwerys BR.
Arthritis Research & Therapy 2009 Apr; 11(2):R57.
Application:IHC-Fr, Human, Human lung cancer.
-
Association study of the IL18RAP locus in three European populations with coeliac disease.
Koskinen LL, Einarsdottir E, Dukes E, Heap GA, Dubois P, Korponay-Szabo IR, Kaukinen K, Kurppa K, Ziberna F, Vatta S, Not T, Ventura A, Sistonen P, Adany R, Pocsai Z, Szeles G, Maki M, Kere J, Wijmenga C, van Heel DA, Saavalainen P.
Human Molecular Genetics 2009 Mar; 18(6):1148.
Application:WB, IHC, Human, PBMCs, Intestine.
-
Gene expression profiling in the synovium identifies a predictive signature of absence of response to adalimumab therapy in rheumatoid arthritis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com