Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL18RAP polyclonal antibody (A01)

  • Catalog # : H00008807-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IL18RAP.
  • Immunogen:
  • IL18RAP (NP_003844, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008807-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IL18RAP polyclonal antibody (A01), Lot # 060104JC01 Western Blot analysis of IL18RAP expression in Y-79 ( Cat # L042V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8807
  • Gene Name:
  • IL18RAP
  • Gene Alias:
  • ACPL,CD218b,CDw218b,IL18RB,MGC120589,MGC120590
  • Gene Description:
  • interleukin 18 receptor accessory protein
  • Gene Summary:
  • The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18. [provided by RefSeq
  • Other Designations:
  • IL-18 receptor beta,OTTHUMP00000161337,accessory protein-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook