Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIF1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008805-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TIF1 partial ORF ( AAH28689, 432 a.a. - 569 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.81
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008805-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8805
  • Gene Name:
  • TRIM24
  • Gene Alias:
  • PTC6,RNF82,TF1A,TIF1,TIF1A,TIF1ALPHA,hTIF1
  • Gene Description:
  • tripartite motif-containing 24
  • Gene Summary:
  • The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • transcriptional intermediary factor 1,transcriptional intermediary factor 1 alpha,tripartite motif protein 24
  • RSS
  • YouTube
  • Linkedin
  • Facebook