CREG1 monoclonal antibody (M01), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CREG1 monoclonal antibody (M01), clone 1B7 Western Blot analysis of CREG1 expression in HL-60 ( Cat # L014V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CREG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREG1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CREG1.
Immunogen
CREG1 (NP_003842, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVTPEEYYNVTVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (76)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CREG1 monoclonal antibody (M01), clone 1B7 Western Blot analysis of CREG1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CREG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREG1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CREG1
Entrez GeneID
8804GeneBank Accession#
NM_003851Protein Accession#
NP_003842Gene Name
CREG1
Gene Alias
CREG
Gene Description
cellular repressor of E1A-stimulated genes 1
Gene Ontology
HyperlinkGene Summary
The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. [provided by RefSeq
Other Designations
OTTHUMP00000032606|cellular repressor of E1A-stimulated genes
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com