Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10B (Human) Recombinant Protein (Q01)

  • Catalog # : H00008795-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF10B partial ORF ( AAH01281, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008795-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8795
  • Gene Name:
  • TNFRSF10B
  • Gene Alias:
  • CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10b
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fas-like protein,OTTHUMP00000123492,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,apoptosis inducing protein TRICK2A/2B,apoptosis inducing receptor TRAIL-R2,cytotoxic TRAIL receptor-2,death domain containing receptor for TRAIL/Apo-2L,d
  • RSS
  • YouTube
  • Linkedin
  • Facebook