Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10B monoclonal antibody (M01), clone 2D6

  • Catalog # : H00008795-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF10B.
  • Immunogen:
  • TNFRSF10B (AAH01281, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008795-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of TNFRSF10B transfected lysate using anti-TNFRSF10B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TNFRSF10B MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TNFRSF10B is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8795
  • Gene Name:
  • TNFRSF10B
  • Gene Alias:
  • CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10b
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fas-like protein,OTTHUMP00000123492,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,apoptosis inducing protein TRICK2A/2B,apoptosis inducing receptor TRAIL-R2,cytotoxic TRAIL receptor-2,death domain containing receptor for TRAIL/Apo-2L,d
  • RSS
  • YouTube
  • Linkedin
  • Facebook