Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10C (Human) Recombinant Protein (P01)

  • Catalog # : H00008794-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF10C full-length ORF ( NP_003832.2, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 53.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008794-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8794
  • Gene Name:
  • TNFRSF10C
  • Gene Alias:
  • CD263,DCR1,LIT,MGC149501,MGC149502,TRAILR3,TRID
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq
  • Other Designations:
  • TNF related TRAIL receptor,TNF related apoptosis-inducing ligand receptor 3,TRAIL receptor 3,antagonist decoy receptor for TRAIL/Apo-2L,decoy receptor 1,decoy without an intracellular domain,lymphocyte inhibitor of TRAIL,tumor necrosis factor receptor sup
  • RSS
  • YouTube
  • Linkedin
  • Facebook