TNFRSF10C MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TNFRSF10C protein.
Immunogen
TNFRSF10C (NP_003832, 1 a.a. ~ 259 a.a) full-length human protein.
Sequence
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNFRSF10C expression in transfected 293T cell line (H00008794-T01) by TNFRSF10C MaxPab polyclonal antibody.
Lane 1: TNFRSF10C transfected lysate(28.49 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TNFRSF10C
Entrez GeneID
8794GeneBank Accession#
NM_003841Protein Accession#
NP_003832Gene Name
TNFRSF10C
Gene Alias
CD263, DCR1, LIT, MGC149501, MGC149502, TRAILR3, TRID
Gene Description
tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Omim ID
603613Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq
Other Designations
TNF related TRAIL receptor|TNF related apoptosis-inducing ligand receptor 3|TRAIL receptor 3|antagonist decoy receptor for TRAIL/Apo-2L|decoy receptor 1|decoy without an intracellular domain|lymphocyte inhibitor of TRAIL|tumor necrosis factor receptor sup
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com