Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10C MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00008794-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TNFRSF10C protein.
  • Immunogen:
  • TNFRSF10C (NP_003832, 1 a.a. ~ 259 a.a) full-length human protein.
  • Sequence:
  • MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TNFRSF10C expression in transfected 293T cell line (H00008794-T01) by TNFRSF10C MaxPab polyclonal antibody.

    Lane 1: TNFRSF10C transfected lysate(28.49 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8794
  • Gene Name:
  • TNFRSF10C
  • Gene Alias:
  • CD263,DCR1,LIT,MGC149501,MGC149502,TRAILR3,TRID
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq
  • Other Designations:
  • TNF related TRAIL receptor,TNF related apoptosis-inducing ligand receptor 3,TRAIL receptor 3,antagonist decoy receptor for TRAIL/Apo-2L,decoy receptor 1,decoy without an intracellular domain,lymphocyte inhibitor of TRAIL,tumor necrosis factor receptor sup
  • RSS
  • YouTube
  • Linkedin
  • Facebook