Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10D polyclonal antibody (A01)

  • Catalog # : H00008793-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TNFRSF10D.
  • Immunogen:
  • TNFRSF10D (NP_003831, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8793
  • Gene Name:
  • TNFRSF10D
  • Gene Alias:
  • CD264,DCR2,TRAILR4,TRUNDD
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis. [provided by RefSeq
  • Other Designations:
  • TNF receptor-related receptor for TRAIL,TRAIL receptor 4,TRAIL receptor with a truncated death domain,decoy receptor 2,decoy with truncated death domain,tumor necrosis factor receptor superfamily, member 10d
  • RSS
  • YouTube
  • Linkedin
  • Facebook