Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FBP2 (Human) Recombinant Protein (P01)

  • Catalog # : H00008789-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FBP2 full-length ORF ( NP_003828.2, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 63.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008789-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8789
  • Gene Name:
  • FBP2
  • Gene Alias:
  • MGC142192
  • Gene Description:
  • fructose-1,6-bisphosphatase 2
  • Gene Summary:
  • This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq
  • Other Designations:
  • D-fructose-1,6-bisphosphate 1-phosphohydrolase,FBPase,OTTHUMP00000021696,fructose-1,6-bisphosphatase isozyme 2,hexosediphosphatase,muscle fructose-bisphosphatase
  • RSS
  • YouTube
  • Linkedin
  • Facebook