Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF18 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008784-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF18 partial ORF ( NP_004186, 26 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008784-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8784
  • Gene Name:
  • TNFRSF18
  • Gene Alias:
  • AITR,GITR,GITR-D
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 18
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001519,OTTHUMP00000001520,OTTHUMP00000001521,TNF receptor superfamily activation-inducible protein,activation-inducible TNFR family receptor,glucocorticoid-induced TNFR-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook