RIOK3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RIOK3 partial ORF ( AAH39729, 411 a.a. - 516 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RIOK3
Entrez GeneID
8780GeneBank Accession#
BC039729Protein Accession#
AAH39729Gene Name
RIOK3
Gene Alias
DKFZp779L1370, SUDD
Gene Description
RIO kinase 3 (yeast)
Omim ID
603579Gene Ontology
HyperlinkGene Summary
This gene was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined. [provided by RefSeq
Other Designations
homolog of the Aspergillus nidulans sudD gene product|sudD (suppressor of bimD6, Aspergillus nidulans) homolog|sudD suppressor of Aspergillus nidulans bimD6 homolog|sudD suppressor of bimD6 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com