RIOK3 monoclonal antibody (M02), clone 3G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RIOK3.
Immunogen
RIOK3 (AAH39729, 411 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RIOK3 monoclonal antibody (M02), clone 3G11 Western Blot analysis of RIOK3 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RIOK3 expression in transfected 293T cell line by RIOK3 monoclonal antibody (M02), clone 3G11.
Lane 1: RIOK3 transfected lysate(59.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RIOK3 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RIOK3 over-expressed 293 cell line, cotransfected with RIOK3 Validated Chimera RNAi ( Cat # H00008780-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RIOK3 monoclonal antibody (M02) clone 3G11 (Cat # H00008780-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RIOK3
Entrez GeneID
8780GeneBank Accession#
BC039729Protein Accession#
AAH39729Gene Name
RIOK3
Gene Alias
DKFZp779L1370, SUDD
Gene Description
RIO kinase 3 (yeast)
Omim ID
603579Gene Ontology
HyperlinkGene Summary
This gene was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined. [provided by RefSeq
Other Designations
homolog of the Aspergillus nidulans sudD gene product|sudD (suppressor of bimD6, Aspergillus nidulans) homolog|sudD suppressor of Aspergillus nidulans bimD6 homolog|sudD suppressor of bimD6 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com