Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SIGLEC5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008778-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SIGLEC5 partial ORF ( NP_003821, 465 a.a. - 549 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.09
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008778-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8778
  • Gene Name:
  • SIGLEC5
  • Gene Alias:
  • CD170,CD33L2,OB-BP2,OBBP2,SIGLEC-5
  • Gene Description:
  • sialic acid binding Ig-like lectin 5
  • Gene Summary:
  • The sialic acid-binding immunoglobulin-like lectins (SIGLECs), such as SIGLEC5, are a subgroup of the immunoglobulin (Ig) superfamily that mediate protein-carbohydrate interactions. They specifically interact with sialic acids in glycoproteins and glycolipids, with each SIGLEC having a particular preference for both the nature of the sialic acid and its glycosidic linkage to adjacent sugars. SIGLECs have similar structures, including extracellular Ig-like domains composed of an N-terminal V-set domain followed by varying numbers of C2-set domains. It appears that all SIGLECs have an unusual arrangement of conserved cysteine residues in the V-set and adjacent C2-set domains. Most SIGLECs are expressed uniquely within the hematopoietic system (Cornish et al., 1998 [PubMed 9731071]).[supplied by OMIM
  • Other Designations:
  • CD33 antigen-like 2,OB binding protein-2,sialic acid-binding immunoglobulin-like lectin 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook