SIGLEC5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SIGLEC5 partial ORF ( NP_003821, 465 a.a. - 549 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.09
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SIGLEC5
Entrez GeneID
8778GeneBank Accession#
NM_003830Protein Accession#
NP_003821Gene Name
SIGLEC5
Gene Alias
CD170, CD33L2, OB-BP2, OBBP2, SIGLEC-5
Gene Description
sialic acid binding Ig-like lectin 5
Omim ID
604200Gene Ontology
HyperlinkGene Summary
The sialic acid-binding immunoglobulin-like lectins (SIGLECs), such as SIGLEC5, are a subgroup of the immunoglobulin (Ig) superfamily that mediate protein-carbohydrate interactions. They specifically interact with sialic acids in glycoproteins and glycolipids, with each SIGLEC having a particular preference for both the nature of the sialic acid and its glycosidic linkage to adjacent sugars. SIGLECs have similar structures, including extracellular Ig-like domains composed of an N-terminal V-set domain followed by varying numbers of C2-set domains. It appears that all SIGLECs have an unusual arrangement of conserved cysteine residues in the V-set and adjacent C2-set domains. Most SIGLECs are expressed uniquely within the hematopoietic system (Cornish et al., 1998 [PubMed 9731071]).[supplied by OMIM
Other Designations
CD33 antigen-like 2|OB binding protein-2|sialic acid-binding immunoglobulin-like lectin 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com