Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MTMR1 (Human) Recombinant Protein (P01)

  • Catalog # : H00008776-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MTMR1 full-length ORF ( AAH11250, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 29.92
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008776-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8776
  • Gene Name:
  • MTMR1
  • Gene Alias:
  • -
  • Gene Description:
  • myotubularin related protein 1
  • Gene Summary:
  • This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025864,myotubularin-related protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook