Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF14 (Human) Recombinant Protein (P01)

  • Catalog # : H00008764-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF14 full-length ORF ( AAH02794, 38 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 52.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008764-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8764
  • Gene Name:
  • TNFRSF14
  • Gene Alias:
  • ATAR,HVEA,HVEM,LIGHTR,TR2
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. [provided by RefSeq
  • Other Designations:
  • CD40-like protein,OTTHUMP00000000866,herpesvirus entry mediator A,tumor necrosis factor receptor superfamily, member 14,tumor necrosis factor receptor-like gene2
  • RSS
  • YouTube
  • Linkedin
  • Facebook