Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF14 monoclonal antibody (M09), clone 8A7

  • Catalog # : H00008764-M09
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF14.
  • Immunogen:
  • TNFRSF14 (AAH02794.1, 38 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008764-M09
    Western Blot detection against Immunogen (20.13 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8764
  • Gene Name:
  • TNFRSF14
  • Gene Alias:
  • ATAR,HVEA,HVEM,LIGHTR,TR2
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. [provided by RefSeq
  • Other Designations:
  • CD40-like protein,OTTHUMP00000000866,herpesvirus entry mediator A,tumor necrosis factor receptor superfamily, member 14,tumor necrosis factor receptor-like gene2
  • RSS
  • YouTube
  • Linkedin
  • Facebook