TNFRSF14 monoclonal antibody (M01), clone 2G6-2C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TNFRSF14.
Immunogen
TNFRSF14 (AAH02794, 38 a.a. ~ 283 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (45); Rat (42)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNFRSF14 expression in transfected 293T cell line by TNFRSF14 monoclonal antibody (M01), clone 2G6-2C7.
Lane 1: TNFRSF14 transfected lysate(30.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TNFRSF14 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNFRSF14 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TNFRSF14
Entrez GeneID
8764GeneBank Accession#
BC002794Protein Accession#
AAH02794Gene Name
TNFRSF14
Gene Alias
ATAR, HVEA, HVEM, LIGHTR, TR2
Gene Description
tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Omim ID
602746Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. [provided by RefSeq
Other Designations
CD40-like protein|OTTHUMP00000000866|herpesvirus entry mediator A|tumor necrosis factor receptor superfamily, member 14|tumor necrosis factor receptor-like gene2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
BTLA-derived peptides as inhibitors of BTLA/HVEM complex formation - design, synthesis and biological evaluation.
Katarzyna Kuncewicz, Magdalena Bojko, Claire Battin, Agnieszka Karczyńska, Adam Sieradzan, Emilia Sikorska, Katarzyna Węgrzyn, Karolina Wojciechowicz, Anna Wardowska, Peter Steinberger, Sylwia Rodziewicz-Motowidło, Marta Spodzieja.
Biomedicine & Pharmacotherapy 2023 Sep; 165:115161.
Application:ELISA, N/A, Recombinant proteins.
-
Targeting the HVEM protein using a fragment of glycoprotein D to inhibit formation of the BTLA/HVEM complex.
Katarzyna Kuncewicz, Claire Battin, Katarzyna Węgrzyn, Adam Sieradzan, Anna Wardowska, Emilia Sikorska, Irma Giedrojć, Pamela Smardz, Michał Pikuła, Peter Steinberger, Sylwia Rodziewicz-Motowidło, Marta Spodzieja.
Bioorganic Chemistry 2022 May; 122:105748.
Application:Con, Recombinant protein.
-
Loss of the HVEM Tumor Suppressor in Lymphoma and Restoration by Modified CAR-T Cells.
Michael Boice, Darin Salloum, Frederic Mourcin, Viraj Sanghvi, Rada Amin, Elisa Oricchio, Man Jiang, Anja Mottok, Nicolas Denis-Lagache, Giovanni Ciriello, Wayne Tam, Julie Teruya-Feldstein, Elisa de Stanchina0, Wing C Chan, Sami N Malek, Daisuke Ennishi, Renier J Brentjens, Randy D Gascoyne, Michel Cogné, Karin Tarte, Hans-Guido Wendel.
Cell 2016 Oct; 167(2):405.
Application:IHC-P, Human, Human follicular lymphomas.
-
BTLA-derived peptides as inhibitors of BTLA/HVEM complex formation - design, synthesis and biological evaluation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com