Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF14 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00008764-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF14 (AAH02794.1 38 a.a. - 200 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSH
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 23.21
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF14 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 8764
  • Gene Name:
  • TNFRSF14
  • Gene Alias:
  • ATAR,HVEA,HVEM,LIGHTR,TR2
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. [provided by RefSeq
  • Other Designations:
  • CD40-like protein,OTTHUMP00000000866,herpesvirus entry mediator A,tumor necrosis factor receptor superfamily, member 14,tumor necrosis factor receptor-like gene2
  • RSS
  • YouTube
  • Linkedin
  • Facebook