CDS2 monoclonal antibody (M01), clone 2B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDS2.
Immunogen
CDS2 (NP_003809, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CDS2 monoclonal antibody (M01), clone 2B9. Western Blot analysis of CDS2 expression in human kidney.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDS2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CDS2
Entrez GeneID
8760GeneBank Accession#
NM_003818Protein Accession#
NP_003809Gene Name
CDS2
Gene Alias
FLJ38111
Gene Description
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Omim ID
603549Gene Ontology
HyperlinkGene Summary
Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. [provided by RefSeq
Other Designations
CDP-DAG synthase 2|CDP-DG synthetase 2|CDP-diacylglycerol synthase 2|CDP-diglyceride diphosphorylase 2|CDP-diglyceride pyrophosphorylase 2|CDP-diglyceride synthetase 2|CTP:phosphatidate cytidylyltransferase 2|OTTHUMP00000030195|phosphatidate cytidylyltran
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Translocation of p53 to Mitochondria Is Regulated by Its Lipid Binding Property to Anionic Phospholipids and It Participates in Cell Death Control.
Li CH, Cheng YW, Liao PL, Kang JJ.
Neoplasia 2010 Feb; 12(2):150.
Application:WB, Human, HepG2 cells.
-
Translocation of p53 to Mitochondria Is Regulated by Its Lipid Binding Property to Anionic Phospholipids and It Participates in Cell Death Control.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com