ADAM20 monoclonal antibody (M05), clone 4B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAM20 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADAM20.
Immunogen
ADAM20 (NP_003805, 268 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (49)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAM20 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ADAM20
Entrez GeneID
8748GeneBank Accession#
NM_003814Protein Accession#
NP_003805Gene Name
ADAM20
Gene Alias
-
Gene Description
ADAM metallopeptidase domain 20
Omim ID
603712Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The expression of this gene is testis-specific. [provided by RefSeq
Other Designations
a disintegrin and metalloproteinase domain 20
-
Interactome
-
Publication Reference
-
Germ cell-specific proteins AKAP4 and ASPX facilitate identification of rare spermatozoa in non-obstructive azoospermia.
Junyan Zhang, Mirzo Kanoatov, Keith Jarvi, Andree Gauthier-Fisher, Sergey I Moskovtsev, Clifford Librach, Andrei P Drabovich.
Molecular & Cellular proteomics: MCP 2023 Apr; 22(6):100556.
Application：IF, Human, Human spermatozoa.
-
Germ cell-specific proteins AKAP4 and ASPX facilitate identification of rare spermatozoa in non-obstructive azoospermia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com