TNFSF12 monoclonal antibody (M01), clone 4H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TNFSF12 monoclonal antibody (M01), clone 4H3. Western Blot analysis of TNFSF12 expression in Raw 264.7.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNFSF12 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TNFSF12.
Immunogen
TNFSF12 (AAH19047, 49 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (84); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TNFSF12 monoclonal antibody (M01), clone 4H3. Western Blot analysis of TNFSF12 expression in Raw 264.7.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNFSF12 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TNFSF12
Entrez GeneID
8742GeneBank Accession#
BC019047Protein Accession#
AAH19047Gene Name
TNFSF12
Gene Alias
APO3L, DR3LG, MGC129581, MGC20669, TWEAK
Gene Description
tumor necrosis factor (ligand) superfamily, member 12
Omim ID
602695Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Some transcripts that skip the last exon of this gene and continue with the second exon of the neighboring TNFSF13 gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq
Other Designations
APO3/DR3 ligand|TNF-related WEAK inducer of apoptosis
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com