Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF12 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00008742-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFSF12 (NP_003800.1 106 a.a. - 249 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • AIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 21.12
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFSF12 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 8742
  • Gene Name:
  • TNFSF12
  • Gene Alias:
  • APO3L,DR3LG,MGC129581,MGC20669,TWEAK
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 12
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Some transcripts that skip the last exon of this gene and continue with the second exon of the neighboring TNFSF13 gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq
  • Other Designations:
  • APO3/DR3 ligand,TNF-related WEAK inducer of apoptosis
  • RSS
  • YouTube
  • Linkedin
  • Facebook