Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF14 (Human) Recombinant Protein (P02)

  • Catalog # : H00008740-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFSF14 full-length ORF ( NP_742011.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008740-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8740
  • Gene Name:
  • TNFSF14
  • Gene Alias:
  • CD258,HVEML,LIGHT,LTg,TR2
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 14
  • Gene Summary:
  • The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • delta transmembrane LIGHT,herpesvirus entry mediator A,ligand for herpesvirus entry mediator,tumor necrosis factor ligand superfamily, member 14,tumor necrosis factor receptor-like 2,tumor necrosis factor superfamily member LIGHT
  • RSS
  • YouTube
  • Linkedin
  • Facebook