TNFSF14 monoclonal antibody (M01), clone 4E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TNFSF14.
Immunogen
TNFSF14 (AAH18058, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGVAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (68)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNFSF14 expression in transfected 293T cell line by TNFSF14 monoclonal antibody (M01), clone 4E3.
Lane 1: TNFSF14 transfected lysate(22.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TNFSF14 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of TNFSF14 transfected lysate using anti-TNFSF14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TNFSF14 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNFSF14 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — TNFSF14
Entrez GeneID
8740GeneBank Accession#
BC018058Protein Accession#
AAH18058Gene Name
TNFSF14
Gene Alias
CD258, HVEML, LIGHT, LTg, TR2
Gene Description
tumor necrosis factor (ligand) superfamily, member 14
Omim ID
604520Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
delta transmembrane LIGHT|herpesvirus entry mediator A|ligand for herpesvirus entry mediator|tumor necrosis factor ligand superfamily, member 14|tumor necrosis factor receptor-like 2|tumor necrosis factor superfamily member LIGHT
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Abundant TNF-LIGHT expression in the airways of patients with asthma with persistent airflow limitation: Association with nitrative and inflammatory profiles.
Tsunahiko Hirano, Kazuto Matsunaga, Keiji Oishi, Keiko Doi, Misa Harada, Junki Suizu, Keita Murakawa, Ayumi Chikumoto, Yuichi Ohteru, Kazuki Matsuda, Sho Uehara, Kazuki Hamada, Shuichiro Ohata, Yoriyuki Murata, Yoshikazu Yamaji, Maki Asami-Noyama, Nobutaka Edakuni.
Respiratory Investigation 2021 Sep; 59(5):651.
Application:ICC, IHC, Human, Human sputum.
-
Abundant TNF-LIGHT expression in the airways of patients with asthma with persistent airflow limitation: Association with nitrative and inflammatory profiles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com