Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF14 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00008740-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFSF14 (NP_742011.1 89 a.a. - 240 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • SHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 22
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFSF14 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 8740
  • Gene Name:
  • TNFSF14
  • Gene Alias:
  • CD258,HVEML,LIGHT,LTg,TR2
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 14
  • Gene Summary:
  • The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • delta transmembrane LIGHT,herpesvirus entry mediator A,ligand for herpesvirus entry mediator,tumor necrosis factor ligand superfamily, member 14,tumor necrosis factor receptor-like 2,tumor necrosis factor superfamily member LIGHT
  • RSS
  • YouTube
  • Linkedin
  • Facebook