Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00008740-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TNFSF14 protein.
  • Immunogen:
  • TNFSF14 (NP_742011.1, 1 a.a. ~ 204 a.a) full-length human protein.
  • Sequence:
  • MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TNFSF14 expression in transfected 293T cell line (H00008740-T03) by TNFSF14 MaxPab polyclonal antibody.

    Lane 1: TNFSF14 transfected lysate(22.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8740
  • Gene Name:
  • TNFSF14
  • Gene Alias:
  • CD258,HVEML,LIGHT,LTg,TR2
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 14
  • Gene Summary:
  • The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • delta transmembrane LIGHT,herpesvirus entry mediator A,ligand for herpesvirus entry mediator,tumor necrosis factor ligand superfamily, member 14,tumor necrosis factor receptor-like 2,tumor necrosis factor superfamily member LIGHT
  • RSS
  • YouTube
  • Linkedin
  • Facebook